PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G180500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 466aa    MW: 49339.8 Da    PI: 6.1546
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G180500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-164794148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WTt Ed  lvd v+++G g+W+++ r  g+ R++k+c++rw ++l
  Sevir.9G180500.1.p 47 KGPWTTAEDAMLVDHVRRHGEGNWNAVQRLTGLLRCGKSCRLRWTNHL 94
                        79******************************99***********996 PP

2Myb_DNA-binding51.13.1e-16100143146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +g+++++E++l++++++qlG++ W++ a++++ gRt++++k++w++
  Sevir.9G180500.1.p 100 KGSFSPDEELLIAQLHAQLGNK-WARMAAHLP-GRTDNEIKNYWNT 143
                         799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.3054294IPR017930Myb domain
SuperFamilySSF466891.61E-2846141IPR009057Homeodomain-like
SMARTSM007172.1E-134696IPR001005SANT/Myb domain
PfamPF002495.7E-144794IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2048101IPR009057Homeodomain-like
CDDcd001671.26E-104994No hitNo description
PROSITE patternPS0017506271IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129422.71795149IPR017930Myb domain
SMARTSM007171.3E-1499147IPR001005SANT/Myb domain
PfamPF002493.2E-15100143IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-24102148IPR009057Homeodomain-like
CDDcd001677.64E-11102143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MERSPGAALT SSPEEEEEKT ADGHAGEEAA AEQEQEEEAA APVVLKKGPW TTAEDAMLVD  60
HVRRHGEGNW NAVQRLTGLL RCGKSCRLRW TNHLRPNLKK GSFSPDEELL IAQLHAQLGN  120
KWARMAAHLP GRTDNEIKNY WNTRTKRRQR AGLPVYPPEV QLQLALAKRR RYDELSPLSG  180
TAVNVQGALD AAAAAAGYTS SRPAPLDLAR QLAATSQTVQ FLSPTPFSAP SSPWAKPFAR  240
NAQYFQLAHS SPVSPSTPTG PLHPVTPDLS LGYGVRGADQ QSRLAPLSPS PGPRVELPSN  300
QFGQAMPPTS AAAAGLGGGA ALPDQHQNAA SLEKMLQELH DAIKVDPPAL APANGDAARP  360
GGGSGAVLER HGGRENKSGG QHRVDDMETL FDLMIPTLNA PETVQVPPAA APNHSSSTSQ  420
HSSDDQDPST VDLGVDLPVA GGGGSSDQDW GLDGVCQWSN MSRIC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-284514825127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0425370.0BT042537.1 Zea mays full-length cDNA clone ZM_BFb0325G13 mRNA, complete cds.
GenBankKJ7275320.0KJ727532.1 Zea mays clone pUT5392 MYB transcription factor (MYB129) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982528.10.0PREDICTED: myb-related protein P-like
TrEMBLK4AL490.0K4AL49_SETIT; Uncharacterized protein
STRINGSi039629m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP74203750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.25e-67myb domain protein 101